Anti TRIM46 pAb (ATL-HPA055583 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055583-25

• 

Protein Description: tripartite motif containing 46
Gene Name: TRIM46
Alternative Gene Name: FLJ23229, TRIFIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042766: 97%, ENSRNOG00000055433: 97%
Entrez Gene ID: 80128
Uniprot ID: Q7Z4K8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYW
• Gene Sequence: LLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWGASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYW
• Gene ID - Mouse: ENSMUSG00000042766
• Gene ID - Rat: ENSRNOG00000055433
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.