Anti TRIM45 pAb (ATL-HPA054308)

Atlas Antibodies

SKU:
ATL-HPA054308-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cytokinetic bridge.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 45
Gene Name: TRIM45
Alternative Gene Name: FLJ13181, RNF99
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033233: 85%, ENSRNOG00000015347: 87%
Entrez Gene ID: 80263
Uniprot ID: Q9H8W5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLE
Gene Sequence LLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLE
Gene ID - Mouse ENSMUSG00000033233
Gene ID - Rat ENSRNOG00000015347
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRIM45 pAb (ATL-HPA054308)
Datasheet Anti TRIM45 pAb (ATL-HPA054308) Datasheet (External Link)
Vendor Page Anti TRIM45 pAb (ATL-HPA054308) at Atlas Antibodies

Documents & Links for Anti TRIM45 pAb (ATL-HPA054308)
Datasheet Anti TRIM45 pAb (ATL-HPA054308) Datasheet (External Link)
Vendor Page Anti TRIM45 pAb (ATL-HPA054308)