Anti TRIM44 pAb (ATL-HPA049053)
Atlas Antibodies
- SKU:
- ATL-HPA049053-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TRIM44
Alternative Gene Name: DIPB, MC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027189: 99%, ENSRNOG00000005191: 96%
Entrez Gene ID: 54765
Uniprot ID: Q96DX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA |
Gene Sequence | LVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGA |
Gene ID - Mouse | ENSMUSG00000027189 |
Gene ID - Rat | ENSRNOG00000005191 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRIM44 pAb (ATL-HPA049053) | |
Datasheet | Anti TRIM44 pAb (ATL-HPA049053) Datasheet (External Link) |
Vendor Page | Anti TRIM44 pAb (ATL-HPA049053) at Atlas Antibodies |
Documents & Links for Anti TRIM44 pAb (ATL-HPA049053) | |
Datasheet | Anti TRIM44 pAb (ATL-HPA049053) Datasheet (External Link) |
Vendor Page | Anti TRIM44 pAb (ATL-HPA049053) |