Anti TRIM32 pAb (ATL-HPA050060)

Atlas Antibodies

SKU:
ATL-HPA050060-100
  • Immunohistochemical staining of human gallbladder shows strong nuclear and cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: tripartite motif containing 32
Gene Name: TRIM32
Alternative Gene Name: BBS11, HT2A, LGMD2H, TATIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051675: 97%, ENSRNOG00000010303: 98%
Entrez Gene ID: 22954
Uniprot ID: Q13049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDA
Gene Sequence NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDA
Gene ID - Mouse ENSMUSG00000051675
Gene ID - Rat ENSRNOG00000010303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRIM32 pAb (ATL-HPA050060)
Datasheet Anti TRIM32 pAb (ATL-HPA050060) Datasheet (External Link)
Vendor Page Anti TRIM32 pAb (ATL-HPA050060) at Atlas Antibodies

Documents & Links for Anti TRIM32 pAb (ATL-HPA050060)
Datasheet Anti TRIM32 pAb (ATL-HPA050060) Datasheet (External Link)
Vendor Page Anti TRIM32 pAb (ATL-HPA050060)