Anti TRIM3 pAb (ATL-HPA048233)

Atlas Antibodies

SKU: ATL-HPA048233-25

• 
• 

Protein Description: tripartite motif containing 3
Gene Name: TRIM3
Alternative Gene Name: BERP, HAC1, RNF22, RNF97
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036989: 99%, ENSRNOG00000018356: 99%
Entrez Gene ID: 10612
Uniprot ID: O75382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQ
• Gene Sequence: QHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQ
• Gene ID - Mouse: ENSMUSG00000036989
• Gene ID - Rat: ENSRNOG00000018356
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.