Anti TRIM27 pAb (ATL-HPA048684)

Atlas Antibodies

SKU: ATL-HPA048684-25

• 
• 

Protein Description: tripartite motif containing 27
Gene Name: TRIM27
Alternative Gene Name: RFP, RNF76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021326: 97%, ENSRNOG00000055917: 97%
Entrez Gene ID: 5987
Uniprot ID: P14373
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSS
• Gene Sequence: VEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSS
• Gene ID - Mouse: ENSMUSG00000021326
• Gene ID - Rat: ENSRNOG00000055917
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.