Anti TRIM26 pAb (ATL-HPA050456)

Atlas Antibodies

SKU: ATL-HPA050456-25

• 
• 

Protein Description: tripartite motif containing 26
Gene Name: TRIM26
Alternative Gene Name: RNF95, ZNF173
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024457: 91%, ENSRNOG00000032930: 89%
Entrez Gene ID: 7726
Uniprot ID: Q12899
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVM
• Gene Sequence: FKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVM
• Gene ID - Mouse: ENSMUSG00000024457
• Gene ID - Rat: ENSRNOG00000032930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.