Anti TRIM17 pAb (ATL-HPA054908)

Atlas Antibodies

SKU: ATL-HPA054908-25

• 
• 

Protein Description: tripartite motif containing 17
Gene Name: TRIM17
Alternative Gene Name: RBCC, RNF16, terf
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036964: 65%, ENSRNOG00000022983: 62%
Entrez Gene ID: 51127
Uniprot ID: Q9Y577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDRQGHSLELLLLQLEERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLE
• Gene Sequence: LDRQGHSLELLLLQLEERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLE
• Gene ID - Mouse: ENSMUSG00000036964
• Gene ID - Rat: ENSRNOG00000022983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.