Protein Description: tripartite motif containing 16
Gene Name: TRIM16
Alternative Gene Name: EBBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047821: 83%, ENSRNOG00000003219: 86%
Entrez Gene ID: 10626
Uniprot ID: O95361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TRIM16
Alternative Gene Name: EBBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047821: 83%, ENSRNOG00000003219: 86%
Entrez Gene ID: 10626
Uniprot ID: O95361
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST |
| Documents & Links for Anti TRIM16 pAb (ATL-HPA066431) | |
| Datasheet | Anti TRIM16 pAb (ATL-HPA066431) Datasheet (External Link) |
| Vendor Page | Anti TRIM16 pAb (ATL-HPA066431) at Atlas |
| Documents & Links for Anti TRIM16 pAb (ATL-HPA066431) | |
| Datasheet | Anti TRIM16 pAb (ATL-HPA066431) Datasheet (External Link) |
| Vendor Page | Anti TRIM16 pAb (ATL-HPA066431) |