Anti TRIB3 pAb (ATL-HPA055442)
Atlas Antibodies
- SKU:
- ATL-HPA055442-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TRIB3
Alternative Gene Name: C20orf97, dJ1103G7.3, TRB3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032715: 44%, ENSRNOG00000007319: 39%
Entrez Gene ID: 57761
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV |
Gene Sequence | VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV |
Gene ID - Mouse | ENSMUSG00000032715 |
Gene ID - Rat | ENSRNOG00000007319 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TRIB3 pAb (ATL-HPA055442) | |
Datasheet | Anti TRIB3 pAb (ATL-HPA055442) Datasheet (External Link) |
Vendor Page | Anti TRIB3 pAb (ATL-HPA055442) at Atlas Antibodies |
Documents & Links for Anti TRIB3 pAb (ATL-HPA055442) | |
Datasheet | Anti TRIB3 pAb (ATL-HPA055442) Datasheet (External Link) |
Vendor Page | Anti TRIB3 pAb (ATL-HPA055442) |