Anti TRIAP1 pAb (ATL-HPA053640)

Atlas Antibodies

SKU:
ATL-HPA053640-25
  • Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TP53 regulated inhibitor of apoptosis 1
Gene Name: TRIAP1
Alternative Gene Name: HSPC132, MDM35, P53CSV, WF-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029535: 98%, ENSRNOG00000001160: 98%
Entrez Gene ID: 51499
Uniprot ID: O43715
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE
Gene Sequence EACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKE
Gene ID - Mouse ENSMUSG00000029535
Gene ID - Rat ENSRNOG00000001160
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRIAP1 pAb (ATL-HPA053640)
Datasheet Anti TRIAP1 pAb (ATL-HPA053640) Datasheet (External Link)
Vendor Page Anti TRIAP1 pAb (ATL-HPA053640) at Atlas Antibodies

Documents & Links for Anti TRIAP1 pAb (ATL-HPA053640)
Datasheet Anti TRIAP1 pAb (ATL-HPA053640) Datasheet (External Link)
Vendor Page Anti TRIAP1 pAb (ATL-HPA053640)