Anti TREX1 pAb (ATL-HPA046721)

Atlas Antibodies

SKU: ATL-HPA046721-25

• 

Protein Description: three prime repair exonuclease 1
Gene Name: TREX1
Alternative Gene Name: AGS1, DRN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049734: 54%, ENSRNOG00000022540: 54%
Entrez Gene ID: 11277
Uniprot ID: Q9NSU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSRE
• Gene Sequence: VDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSRE
• Gene ID - Mouse: ENSMUSG00000049734
• Gene ID - Rat: ENSRNOG00000022540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.