Anti TRERF1 pAb (ATL-HPA051273)

Atlas Antibodies

SKU: ATL-HPA051273-25

• 
• 

Protein Description: transcriptional regulating factor 1
Gene Name: TRERF1
Alternative Gene Name: BCAR2, dJ139D8.5, HSA277276, RAPA, TReP-132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049295: 29%, ENSRNOG00000022598: 93%
Entrez Gene ID: 55809
Uniprot ID: Q96PN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG
• Gene Sequence: PSGIHLNNMGPQHQQLSPSAMWPQMHLPDGRAQPGSPESSGQPKGAFGEQFDAKNKLTCSICLKEFKNLPALNGHMRSHG
• Gene ID - Mouse: ENSMUSG00000049295
• Gene ID - Rat: ENSRNOG00000022598
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.