Anti TRAPPC6B pAb (ATL-HPA047928)

Atlas Antibodies

SKU:
ATL-HPA047928-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: trafficking protein particle complex 6B
Gene Name: TRAPPC6B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020993: 97%, ENSRNOG00000004103: 100%
Entrez Gene ID: 122553
Uniprot ID: Q86SZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLE
Gene Sequence MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLE
Gene ID - Mouse ENSMUSG00000020993
Gene ID - Rat ENSRNOG00000004103
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRAPPC6B pAb (ATL-HPA047928)
Datasheet Anti TRAPPC6B pAb (ATL-HPA047928) Datasheet (External Link)
Vendor Page Anti TRAPPC6B pAb (ATL-HPA047928) at Atlas Antibodies

Documents & Links for Anti TRAPPC6B pAb (ATL-HPA047928)
Datasheet Anti TRAPPC6B pAb (ATL-HPA047928) Datasheet (External Link)
Vendor Page Anti TRAPPC6B pAb (ATL-HPA047928)