Anti TRAPPC1 pAb (ATL-HPA052398)

Atlas Antibodies

SKU: ATL-HPA052398-25

• 

Protein Description: trafficking protein particle complex 1
Gene Name: TRAPPC1
Alternative Gene Name: BET5, MUM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049299: 99%, ENSRNOG00000037627: 99%
Entrez Gene ID: 58485
Uniprot ID: Q9Y5R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKL
• Gene Sequence: TVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKL
• Gene ID - Mouse: ENSMUSG00000049299
• Gene ID - Rat: ENSRNOG00000037627
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.