Anti TRAF4 pAb (ATL-HPA052377 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052377-100
  • Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using Anti-TRAF4 antibody. Corresponding TRAF4 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell lines HeLa and PC-3 using Anti-TRAF4 antibody. Corresponding TRAF4 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: TNF receptor-associated factor 4
Gene Name: TRAF4
Alternative Gene Name: CART1, MLN62, RNF83
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017386: 99%, ENSRNOG00000013169: 99%
Entrez Gene ID: 9618
Uniprot ID: Q9BUZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI
Gene Sequence GAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKI
Gene ID - Mouse ENSMUSG00000017386
Gene ID - Rat ENSRNOG00000013169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TRAF4 pAb (ATL-HPA052377 w/enhanced validation)
Datasheet Anti TRAF4 pAb (ATL-HPA052377 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TRAF4 pAb (ATL-HPA052377 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TRAF4 pAb (ATL-HPA052377 w/enhanced validation)
Datasheet Anti TRAF4 pAb (ATL-HPA052377 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TRAF4 pAb (ATL-HPA052377 w/enhanced validation)