Anti TPSG1 pAb (ATL-HPA060458 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060458-25

• 

Protein Description: tryptase gamma 1
Gene Name: TPSG1
Alternative Gene Name: PRSS31, TMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033200: 65%, ENSRNOG00000018701: 59%
Entrez Gene ID: 25823
Uniprot ID: Q9NRR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR
• Gene Sequence: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR
• Gene ID - Mouse: ENSMUSG00000033200
• Gene ID - Rat: ENSRNOG00000018701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.