Anti TPRG1 pAb (ATL-HPA060187)

Atlas Antibodies

SKU:
ATL-HPA060187-25
  • Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tumor protein p63 regulated 1
Gene Name: TPRG1
Alternative Gene Name: FAM79B, FLJ41238, FLJ43694
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048399: 85%, ENSRNOG00000001923: 85%
Entrez Gene ID: 285386
Uniprot ID: Q6ZUI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG
Gene Sequence TFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTG
Gene ID - Mouse ENSMUSG00000048399
Gene ID - Rat ENSRNOG00000001923
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TPRG1 pAb (ATL-HPA060187)
Datasheet Anti TPRG1 pAb (ATL-HPA060187) Datasheet (External Link)
Vendor Page Anti TPRG1 pAb (ATL-HPA060187) at Atlas Antibodies

Documents & Links for Anti TPRG1 pAb (ATL-HPA060187)
Datasheet Anti TPRG1 pAb (ATL-HPA060187) Datasheet (External Link)
Vendor Page Anti TPRG1 pAb (ATL-HPA060187)