Anti TPI1 pAb (ATL-HPA050924 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050924-25
  • Immunohistochemical staining of human parathyroid gland shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & vesicles.
  • Western blot analysis using Anti-TPI1 antibody HPA050924 (A) shows similar pattern to independent antibody HPA053568 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: triosephosphate isomerase 1
Gene Name: TPI1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023456: 77%, ENSRNOG00000050669: 78%
Entrez Gene ID: 7167
Uniprot ID: P60174
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEEAEFHFAALYISGQWPRLRADTDLQRLGSSAMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDP
Gene Sequence GEEAEFHFAALYISGQWPRLRADTDLQRLGSSAMAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDP
Gene ID - Mouse ENSMUSG00000023456
Gene ID - Rat ENSRNOG00000050669
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TPI1 pAb (ATL-HPA050924 w/enhanced validation)
Datasheet Anti TPI1 pAb (ATL-HPA050924 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPI1 pAb (ATL-HPA050924 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TPI1 pAb (ATL-HPA050924 w/enhanced validation)
Datasheet Anti TPI1 pAb (ATL-HPA050924 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TPI1 pAb (ATL-HPA050924 w/enhanced validation)