Anti TP53 pAb (ATL-HPA051244 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051244-25

• 
• 

Protein Description: tumor protein p53
Gene Name: TP53
Alternative Gene Name: TP53, LFS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059552: 75%, ENSRNOG00000046657: 91%
Entrez Gene ID: 7157
Uniprot ID: P04637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR
• Gene Sequence: KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR
• Gene ID - Mouse: ENSMUSG00000059552
• Gene ID - Rat: ENSRNOG00000046657
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TP53 pAb (ATL-HPA051244 w/enhanced validation) – 1 Found

Zhao, Liang; Cheng, Zhe; Lu, Zhiyue; Jin, Jianqiu. NAD-dependent methylenetetrahydrofolate dehydrogenase inhibits oral squamous cell carcinoma cell proliferation and promotes apoptosis. Translational Cancer Research. 2021;10(3):1457-1469.