Anti TOR1AIP2 pAb (ATL-HPA058348)

Atlas Antibodies

SKU: ATL-HPA058348-25

• 

Protein Description: torsin A interacting protein 2
Gene Name: TOR1AIP2
Alternative Gene Name: IFRG15, LULL1, NET9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050565: 100%, ENSRNOG00000048267: 100%
Entrez Gene ID: 163590
Uniprot ID: Q9H496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV
• Gene Sequence: SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV
• Gene ID - Mouse: ENSMUSG00000050565
• Gene ID - Rat: ENSRNOG00000048267
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.