Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050546-25

• 
• 
• 

Protein Description: torsin A interacting protein 1
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 46%, ENSRNOG00000003946: 47%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQ
• Gene Sequence: EATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQ
• Gene ID - Mouse: ENSMUSG00000026466
• Gene ID - Rat: ENSRNOG00000003946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TOR1AIP1 pAb (ATL-HPA050546 w/enhanced validation) – 3 Found

Lessel, Ivana; Chen, Mei-Jan; Lüttgen, Sabine; Arndt, Florian; Fuchs, Sigrid; Meien, Stefanie; Thiele, Holger; Jones, Julie R; Shaw, Brandon R; Crossman, David K; Nürnberg, Peter; Korf, Bruce R; Kubisch, Christian; Lessel, Davor. Two novel cases further expand the phenotype of TOR1AIP1-associated nuclear envelopathies. Human Genetics. 2020;139(4):483-498. 

Pereira, Cátia D; Martins, Filipa; Santos, Mariana; Müeller, Thorsten; da Cruz E Silva, Odete A B; Rebelo, Sandra. Nuclear Accumulation of LAP1:TRF2 Complex during DNA Damage Response Uncovers a Novel Role for LAP1. Cells. 2020;9(8) 

Cossins, Judith; Webster, Richard; Maxwell, Susan; Rodríguez Cruz, Pedro M; Knight, Ravi; Llewelyn, John Gareth; Shin, Ji-Yeon; Palace, Jacqueline; Beeson, David. Congenital myasthenic syndrome due to a TOR1AIP1 mutation: a new disease pathway for impaired synaptic transmission. Brain Communications. 2(2):fcaa174.