Anti TOR1AIP1 pAb (ATL-HPA047151 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047151-25

• 
• 

Protein Description: torsin A interacting protein 1
Gene Name: TOR1AIP1
Alternative Gene Name: FLJ13142, LAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026466: 66%, ENSRNOG00000003946: 69%
Entrez Gene ID: 26092
Uniprot ID: Q5JTV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVTTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRS
• Gene Sequence: EEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVTTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRS
• Gene ID - Mouse: ENSMUSG00000026466
• Gene ID - Rat: ENSRNOG00000003946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TOR1AIP1 pAb (ATL-HPA047151 w/enhanced validation) – 1 Found

Kayman Kürekçi, Gülsüm; Acar, Aybar C; Dinçer, Pervin R. Loss of the Nuclear Envelope Protein LAP1B Disrupts the Myogenic Differentiation of Patient-Derived Fibroblasts. International Journal Of Molecular Sciences. 2022;23(21)