Anti TOR1A pAb (ATL-HPA051195)

Atlas Antibodies

SKU: ATL-HPA051195-25

• 

Protein Description: torsin family 1, member A (torsin A)
Gene Name: TOR1A
Alternative Gene Name: DQ2, DYT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026849: 88%, ENSRNOG00000006894: 92%
Entrez Gene ID: 1861
Uniprot ID: O14656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK
• Gene Sequence: QAVEPISLGLALAGVLTGYIYPRLYCLFAECCGQKRSLSREALQKDLDDNLFGQHLAKK
• Gene ID - Mouse: ENSMUSG00000026849
• Gene ID - Rat: ENSRNOG00000006894
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.