Anti TOPAZ1 pAb (ATL-HPA051034)

Atlas Antibodies

Catalog No.: ATL-HPA051034-25

Protein Description: testis and ovary specific PAZ domain containing 1
Gene Name: TOPAZ1
Alternative Gene Name: C3orf77, FLJ36157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094985: 55%, ENSRNOG00000025601: 57%
Entrez Gene ID: 375337
Uniprot ID: Q8N9V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM
• Gene Sequence: KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM
• Gene ID - Mouse: ENSMUSG00000094985
• Gene ID - Rat: ENSRNOG00000025601
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.