Anti TOPAZ1 pAb (ATL-HPA051034)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051034-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TOPAZ1
Alternative Gene Name: C3orf77, FLJ36157
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094985: 55%, ENSRNOG00000025601: 57%
Entrez Gene ID: 375337
Uniprot ID: Q8N9V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM |
Gene Sequence | KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM |
Gene ID - Mouse | ENSMUSG00000094985 |
Gene ID - Rat | ENSRNOG00000025601 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TOPAZ1 pAb (ATL-HPA051034) | |
Datasheet | Anti TOPAZ1 pAb (ATL-HPA051034) Datasheet (External Link) |
Vendor Page | Anti TOPAZ1 pAb (ATL-HPA051034) at Atlas Antibodies |
Documents & Links for Anti TOPAZ1 pAb (ATL-HPA051034) | |
Datasheet | Anti TOPAZ1 pAb (ATL-HPA051034) Datasheet (External Link) |
Vendor Page | Anti TOPAZ1 pAb (ATL-HPA051034) |