Anti TONSL pAb (ATL-HPA046494)

Atlas Antibodies

SKU:
ATL-HPA046494-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: tonsoku-like, DNA repair protein
Gene Name: TONSL
Alternative Gene Name: IKBR, NFKBIL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059323: 84%, ENSRNOG00000014703: 88%
Entrez Gene ID: 4796
Uniprot ID: Q96HA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRVRVQVQDHLFLIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWDLPPLTDRYRRACQSLGQGEHQQVLQAVELQGLGLSFSACSLALDQAQLTPLLRALKLHT
Gene Sequence IRVRVQVQDHLFLIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWDLPPLTDRYRRACQSLGQGEHQQVLQAVELQGLGLSFSACSLALDQAQLTPLLRALKLHT
Gene ID - Mouse ENSMUSG00000059323
Gene ID - Rat ENSRNOG00000014703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TONSL pAb (ATL-HPA046494)
Datasheet Anti TONSL pAb (ATL-HPA046494) Datasheet (External Link)
Vendor Page Anti TONSL pAb (ATL-HPA046494) at Atlas Antibodies

Documents & Links for Anti TONSL pAb (ATL-HPA046494)
Datasheet Anti TONSL pAb (ATL-HPA046494) Datasheet (External Link)
Vendor Page Anti TONSL pAb (ATL-HPA046494)



Citations for Anti TONSL pAb (ATL-HPA046494) – 1 Found
Hammond, Colin M; Bao, Hongyu; Hendriks, Ivo A; Carraro, Massimo; García-Nieto, Alberto; Liu, Yanhong; Reverón-Gómez, Nazaret; Spanos, Christos; Chen, Liu; Rappsilber, Juri; Nielsen, Michael L; Patel, Dinshaw J; Huang, Hongda; Groth, Anja. DNAJC9 integrates heat shock molecular chaperones into the histone chaperone network. Molecular Cell. 2021;81(12):2533-2548.e9.  PubMed