Anti TOMM40L pAb (ATL-HPA051304)

Atlas Antibodies

SKU: ATL-HPA051304-25

• 

Protein Description: translocase of outer mitochondrial membrane 40 homolog (yeast)-like
Gene Name: TOMM40L
Alternative Gene Name: FLJ12770, TOMM40B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005674: 96%, ENSRNOG00000003398: 96%
Entrez Gene ID: 84134
Uniprot ID: Q969M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM
• Gene Sequence: VVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDM
• Gene ID - Mouse: ENSMUSG00000005674
• Gene ID - Rat: ENSRNOG00000003398
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.