Anti TOMM40 pAb (ATL-HPA036231)

Atlas Antibodies

SKU:
ATL-HPA036231-25
  • Immunohistochemical staining of human cerebral cortex shows weak granular positivity in cytoplasm in neurons.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to mitochondria.
  • Western blot analysis in human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: translocase of outer mitochondrial membrane 40 homolog (yeast)
Gene Name: TOMM40
Alternative Gene Name: C19orf1, D19S1177E, PER-EC1, PEREC1, TOM40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002984: 80%, ENSRNOG00000018556: 73%
Entrez Gene ID: 10452
Uniprot ID: O96008
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
Gene Sequence FTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQM
Gene ID - Mouse ENSMUSG00000002984
Gene ID - Rat ENSRNOG00000018556
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TOMM40 pAb (ATL-HPA036231)
Datasheet Anti TOMM40 pAb (ATL-HPA036231) Datasheet (External Link)
Vendor Page Anti TOMM40 pAb (ATL-HPA036231) at Atlas Antibodies

Documents & Links for Anti TOMM40 pAb (ATL-HPA036231)
Datasheet Anti TOMM40 pAb (ATL-HPA036231) Datasheet (External Link)
Vendor Page Anti TOMM40 pAb (ATL-HPA036231)



Citations for Anti TOMM40 pAb (ATL-HPA036231) – 1 Found
Utsumi, Toshihiko; Matsuzaki, Kanako; Kiwado, Aya; Tanikawa, Ayane; Kikkawa, Yuki; Hosokawa, Takuro; Otsuka, Aoi; Iuchi, Yoshihito; Kobuchi, Hirotsugu; Moriya, Koko. Identification and characterization of protein N-myristoylation occurring on four human mitochondrial proteins, SAMM50, TOMM40, MIC19, and MIC25. Plos One. 13(11):e0206355.  PubMed