Anti TOM1 pAb (ATL-HPA001749)

Atlas Antibodies

SKU:
ATL-HPA001749-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
  • Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line EFO-21<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: target of myb1 (chicken)
Gene Name: TOM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042870: 90%, ENSRNOG00000014093: 89%
Entrez Gene ID: 10043
Uniprot ID: O60784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Gene Sequence LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Gene ID - Mouse ENSMUSG00000042870
Gene ID - Rat ENSRNOG00000014093
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TOM1 pAb (ATL-HPA001749)
Datasheet Anti TOM1 pAb (ATL-HPA001749) Datasheet (External Link)
Vendor Page Anti TOM1 pAb (ATL-HPA001749) at Atlas Antibodies

Documents & Links for Anti TOM1 pAb (ATL-HPA001749)
Datasheet Anti TOM1 pAb (ATL-HPA001749) Datasheet (External Link)
Vendor Page Anti TOM1 pAb (ATL-HPA001749)