Anti TOE1 pAb (ATL-HPA053775)

Atlas Antibodies

SKU:
ATL-HPA053775-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & nuclear bodies.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: target of EGR1, member 1 (nuclear)
Gene Name: TOE1
Alternative Gene Name: hCaf1z
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028688: 89%, ENSRNOG00000017561: 89%
Entrez Gene ID: 114034
Uniprot ID: Q96GM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAGSPHLTLEFCNYPSSMRDHIDYRCCLPPATHRPHPTSICDNFSAYGWCPLGPQCPQSHDIDL
Gene Sequence LIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAGSPHLTLEFCNYPSSMRDHIDYRCCLPPATHRPHPTSICDNFSAYGWCPLGPQCPQSHDIDL
Gene ID - Mouse ENSMUSG00000028688
Gene ID - Rat ENSRNOG00000017561
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TOE1 pAb (ATL-HPA053775)
Datasheet Anti TOE1 pAb (ATL-HPA053775) Datasheet (External Link)
Vendor Page Anti TOE1 pAb (ATL-HPA053775) at Atlas Antibodies

Documents & Links for Anti TOE1 pAb (ATL-HPA053775)
Datasheet Anti TOE1 pAb (ATL-HPA053775) Datasheet (External Link)
Vendor Page Anti TOE1 pAb (ATL-HPA053775)