Anti TOB2 pAb (ATL-HPA054112)

Atlas Antibodies

SKU: ATL-HPA054112-25

• 

Protein Description: transducer of ERBB2, 2
Gene Name: TOB2
Alternative Gene Name: bK223H9, TOB4, TOBL, TROB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048546: 82%, ENSRNOG00000050500: 82%
Entrez Gene ID: 10766
Uniprot ID: Q14106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS
• Gene Sequence: GVASSGAGGQQPPQQPRMARSPTNSLLKHKSLS
• Gene ID - Mouse: ENSMUSG00000048546
• Gene ID - Rat: ENSRNOG00000050500
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.