Anti TNS3 pAb (ATL-HPA056015)

Atlas Antibodies

SKU: ATL-HPA056015-25

• 
• 

Protein Description: tensin 3
Gene Name: TNS3
Alternative Gene Name: FLJ13732, H_NH0549I23.2, TEM6, TENS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020422: 69%, ENSRNOG00000025695: 73%
Entrez Gene ID: 64759
Uniprot ID: Q68CZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
• Gene Sequence: VGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNALGSQANGSV
• Gene ID - Mouse: ENSMUSG00000020422
• Gene ID - Rat: ENSRNOG00000025695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.