Anti TNFSF12 pAb (ATL-HPA052967)

Atlas Antibodies

SKU: ATL-HPA052967-25

• 

Protein Description: tumor necrosis factor (ligand) superfamily, member 12
Gene Name: TNFSF12
Alternative Gene Name: APO3L, DR3LG, TWEAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018752: 84%, ENSRNOG00000045670: 81%
Entrez Gene ID: 8742
Uniprot ID: O43508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYC
• Gene Sequence: QEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYC
• Gene ID - Mouse: ENSMUSG00000018752
• Gene ID - Rat: ENSRNOG00000045670
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.