Anti TNFSF10 pAb (ATL-HPA054938)

Atlas Antibodies

SKU: ATL-HPA054938-25

• 
• 

Protein Description: tumor necrosis factor (ligand) superfamily, member 10
Gene Name: TNFSF10
Alternative Gene Name: Apo-2L, CD253, TL2, TRAIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039304: 86%, ENSRNOG00000013269: 89%
Entrez Gene ID: 8743
Uniprot ID: P50591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS
• Gene Sequence: GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS
• Gene ID - Mouse: ENSMUSG00000039304
• Gene ID - Rat: ENSRNOG00000013269
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.