Anti TNFAIP8 pAb (ATL-HPA057089)

Atlas Antibodies

SKU: ATL-HPA057089-25

• 
• 
• 

Protein Description: tumor necrosis factor, alpha-induced protein 8
Gene Name: TNFAIP8
Alternative Gene Name: GG2-1, MDC-3.13, SCC-S2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062210: 96%, ENSRNOG00000026136: 96%
Entrez Gene ID: 25816
Uniprot ID: O95379
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
• Gene Sequence: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
• Gene ID - Mouse: ENSMUSG00000062210
• Gene ID - Rat: ENSRNOG00000026136
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TNFAIP8 pAb (ATL-HPA057089) – 1 Found

Rodríguez-Barrueco, Ruth; Latorre, Jessica; Devis-Jáuregui, Laura; Lluch, Aina; Bonifaci, Nuria; Llobet, Francisco J; Olivan, Mireia; Coll-Iglesias, Laura; Gassner, Katja; Davis, Meredith L; Moreno-Navarrete, José M; Castells-Nobau, Anna; Plata-Peña, Laura; Dalmau-Pastor, Miki; Höring, Marcus; Liebisch, Gerhard; Olkkonen, Vesa M; Arnoriaga-Rodríguez, Maria; Ricart, Wifredo; Fernández-Real, José M; Silva, José M; Ortega, Francisco J; Llobet-Navas, David. A microRNA Cluster Controls Fat Cell Differentiation and Adipose Tissue Expansion By Regulating SNCG. Advanced Science (Weinheim, Baden-Wurttemberg, Germany). 2022;9(4):e2104759.