Anti TMTC4 pAb (ATL-HPA057056)

Atlas Antibodies

SKU: ATL-HPA057056-25

• 

Protein Description: transmembrane and tetratricopeptide repeat containing 4
Gene Name: TMTC4
Alternative Gene Name: FLJ14624, FLJ22153
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041594: 98%, ENSRNOG00000014310: 98%
Entrez Gene ID: 84899
Uniprot ID: Q5T4D3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYY
• Gene Sequence: LQEAEELLSLAVQIQPDFAAAWMNLGIVQNSLKRFEAAEQSYRTAIKHRRKYPDCYY
• Gene ID - Mouse: ENSMUSG00000041594
• Gene ID - Rat: ENSRNOG00000014310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.