Anti TMOD1 pAb (ATL-HPA051202 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051202-25

• 

Protein Description: tropomodulin 1
Gene Name: TMOD1
Alternative Gene Name: D9S57E, ETMOD, TMOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028328: 94%, ENSRNOG00000009761: 94%
Entrez Gene ID: 7111
Uniprot ID: P28289
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSNQQYYQALSSSSIMNKEGLNSVIKPTQYK
• Gene Sequence: MSNQQYYQALSSSSIMNKEGLNSVIKPTQYK
• Gene ID - Mouse: ENSMUSG00000028328
• Gene ID - Rat: ENSRNOG00000009761
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.