Anti TMEM8B pAb (ATL-HPA052130)

Atlas Antibodies

SKU:
ATL-HPA052130-25
  • Immunohistochemical staining of human appendix shows strong nuclear and cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 8B
Gene Name: TMEM8B
Alternative Gene Name: C9orf127, NAG-5, NGX6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078716: 90%, ENSRNOG00000015664: 89%
Entrez Gene ID: 51754
Uniprot ID: A6NDV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD
Gene Sequence MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRLLPVLD
Gene ID - Mouse ENSMUSG00000078716
Gene ID - Rat ENSRNOG00000015664
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM8B pAb (ATL-HPA052130)
Datasheet Anti TMEM8B pAb (ATL-HPA052130) Datasheet (External Link)
Vendor Page Anti TMEM8B pAb (ATL-HPA052130) at Atlas Antibodies

Documents & Links for Anti TMEM8B pAb (ATL-HPA052130)
Datasheet Anti TMEM8B pAb (ATL-HPA052130) Datasheet (External Link)
Vendor Page Anti TMEM8B pAb (ATL-HPA052130)