Protein Description: transmembrane protein 8A
Gene Name: TMEM8A
Alternative Gene Name: M83, TMEM6, TMEM8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024180: 81%, ENSRNOG00000020374: 82%
Entrez Gene ID: 58986
Uniprot ID: Q9HCN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM8A
Alternative Gene Name: M83, TMEM6, TMEM8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024180: 81%, ENSRNOG00000020374: 82%
Entrez Gene ID: 58986
Uniprot ID: Q9HCN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PFLGFNTSLNCTTAFFQGYPLSLSAWSRRANLIIPYPETDNWYLSLQLMCPENAEDCEQAVVHVETTLYLVPC |
| Documents & Links for Anti TMEM8A pAb (ATL-HPA064673) | |
| Datasheet | Anti TMEM8A pAb (ATL-HPA064673) Datasheet (External Link) |
| Vendor Page | Anti TMEM8A pAb (ATL-HPA064673) at Atlas |
| Documents & Links for Anti TMEM8A pAb (ATL-HPA064673) | |
| Datasheet | Anti TMEM8A pAb (ATL-HPA064673) Datasheet (External Link) |
| Vendor Page | Anti TMEM8A pAb (ATL-HPA064673) |