Anti TMEM8A pAb (ATL-HPA051281)
Atlas Antibodies
- SKU:
- ATL-HPA051281-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TMEM8A
Alternative Gene Name: M83, TMEM6, TMEM8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024180: 73%, ENSRNOG00000020374: 75%
Entrez Gene ID: 58986
Uniprot ID: Q9HCN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL |
Gene Sequence | TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL |
Gene ID - Mouse | ENSMUSG00000024180 |
Gene ID - Rat | ENSRNOG00000020374 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM8A pAb (ATL-HPA051281) | |
Datasheet | Anti TMEM8A pAb (ATL-HPA051281) Datasheet (External Link) |
Vendor Page | Anti TMEM8A pAb (ATL-HPA051281) at Atlas Antibodies |
Documents & Links for Anti TMEM8A pAb (ATL-HPA051281) | |
Datasheet | Anti TMEM8A pAb (ATL-HPA051281) Datasheet (External Link) |
Vendor Page | Anti TMEM8A pAb (ATL-HPA051281) |