Anti TMEM81 pAb (ATL-HPA052515)

Atlas Antibodies

SKU: ATL-HPA052515-25

• 
• 

Protein Description: transmembrane protein 81
Gene Name: TMEM81
Alternative Gene Name: HC3107, KVLA2788, MGC75217, UNQ2788
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048174: 80%, ENSRNOG00000028752: 76%
Entrez Gene ID: 388730
Uniprot ID: Q6P7N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWK
• Gene Sequence: NLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWK
• Gene ID - Mouse: ENSMUSG00000048174
• Gene ID - Rat: ENSRNOG00000028752
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.