Anti TMEM74B pAb (ATL-HPA045213)

Atlas Antibodies

SKU:
ATL-HPA045213-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 74B
Gene Name: TMEM74B
Alternative Gene Name: C20orf46, FLJ11190
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044364: 66%, ENSRNOG00000009635: 66%
Entrez Gene ID: 55321
Uniprot ID: Q9NUR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVS
Gene Sequence MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVS
Gene ID - Mouse ENSMUSG00000044364
Gene ID - Rat ENSRNOG00000009635
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM74B pAb (ATL-HPA045213)
Datasheet Anti TMEM74B pAb (ATL-HPA045213) Datasheet (External Link)
Vendor Page Anti TMEM74B pAb (ATL-HPA045213) at Atlas Antibodies

Documents & Links for Anti TMEM74B pAb (ATL-HPA045213)
Datasheet Anti TMEM74B pAb (ATL-HPA045213) Datasheet (External Link)
Vendor Page Anti TMEM74B pAb (ATL-HPA045213)