Protein Description: transmembrane protein 63A
Gene Name: TMEM63A
Alternative Gene Name: KIAA0792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026519: 94%, ENSRNOG00000003310: 85%
Entrez Gene ID: 9725
Uniprot ID: O94886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM63A
Alternative Gene Name: KIAA0792
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026519: 94%, ENSRNOG00000003310: 85%
Entrez Gene ID: 9725
Uniprot ID: O94886
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FKHLSPLNYKTEEPASDKGSEAEAHMPPPFTPYVPRILNGLASERTAL |
| Documents & Links for Anti TMEM63A pAb (ATL-HPA066504) | |
| Datasheet | Anti TMEM63A pAb (ATL-HPA066504) Datasheet (External Link) |
| Vendor Page | Anti TMEM63A pAb (ATL-HPA066504) at Atlas |
| Documents & Links for Anti TMEM63A pAb (ATL-HPA066504) | |
| Datasheet | Anti TMEM63A pAb (ATL-HPA066504) Datasheet (External Link) |
| Vendor Page | Anti TMEM63A pAb (ATL-HPA066504) |