Anti TMEM59 pAb (ATL-HPA075447)

Atlas Antibodies

SKU:
ATL-HPA075447-100
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 59
Gene Name: TMEM59
Alternative Gene Name: C1orf8, HSPC001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028618: 94%, ENSRNOG00000009778: 92%
Entrez Gene ID: 9528
Uniprot ID: Q9BXS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSSDLQMRNSQAHRNFLEDGESDGFLRCLSLNSGW
Gene Sequence HLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSSDLQMRNSQAHRNFLEDGESDGFLRCLSLNSGW
Gene ID - Mouse ENSMUSG00000028618
Gene ID - Rat ENSRNOG00000009778
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM59 pAb (ATL-HPA075447)
Datasheet Anti TMEM59 pAb (ATL-HPA075447) Datasheet (External Link)
Vendor Page Anti TMEM59 pAb (ATL-HPA075447) at Atlas Antibodies

Documents & Links for Anti TMEM59 pAb (ATL-HPA075447)
Datasheet Anti TMEM59 pAb (ATL-HPA075447) Datasheet (External Link)
Vendor Page Anti TMEM59 pAb (ATL-HPA075447)