Protein Description: transmembrane protein 59
Gene Name: TMEM59
Alternative Gene Name: C1orf8, HSPC001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028618: 94%, ENSRNOG00000009778: 92%
Entrez Gene ID: 9528
Uniprot ID: Q9BXS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: TMEM59
Alternative Gene Name: C1orf8, HSPC001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028618: 94%, ENSRNOG00000009778: 92%
Entrez Gene ID: 9528
Uniprot ID: Q9BXS4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSSDLQMRNSQAHRNFLEDGESDGFLRCLSLNSGW |
Documents & Links for Anti TMEM59 pAb (ATL-HPA075447) | |
Datasheet | Anti TMEM59 pAb (ATL-HPA075447) Datasheet (External Link) |
Vendor Page | Anti TMEM59 pAb (ATL-HPA075447) at Atlas |
Documents & Links for Anti TMEM59 pAb (ATL-HPA075447) | |
Datasheet | Anti TMEM59 pAb (ATL-HPA075447) Datasheet (External Link) |
Vendor Page | Anti TMEM59 pAb (ATL-HPA075447) |