Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA058096-25
  • Immunohistochemistry analysis in human kidney and liver tissues using HPA058096 antibody. Corresponding TMEM52B RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to focal adhesion sites.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and TMEM52B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407200).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: transmembrane protein 52B
Gene Name: TMEM52B
Alternative Gene Name: C12orf59, FLJ31166
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030160: 75%, ENSRNOG00000058653: 77%
Entrez Gene ID: 120939
Uniprot ID: Q4KMG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
Gene Sequence QLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
Gene ID - Mouse ENSMUSG00000030160
Gene ID - Rat ENSRNOG00000058653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation)
Datasheet Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation)
Datasheet Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM52B pAb (ATL-HPA058096 w/enhanced validation)

!