Anti TMEM42 pAb (ATL-HPA052569)

Atlas Antibodies

SKU:
ATL-HPA052569-25
  • Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells with distinct reticular pattern.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 42
Gene Name: TMEM42
Alternative Gene Name: MGC29956
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066233: 64%, ENSRNOG00000032027: 67%
Entrez Gene ID: 131616
Uniprot ID: Q69YG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRR
Gene Sequence MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRR
Gene ID - Mouse ENSMUSG00000066233
Gene ID - Rat ENSRNOG00000032027
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TMEM42 pAb (ATL-HPA052569)
Datasheet Anti TMEM42 pAb (ATL-HPA052569) Datasheet (External Link)
Vendor Page Anti TMEM42 pAb (ATL-HPA052569) at Atlas Antibodies

Documents & Links for Anti TMEM42 pAb (ATL-HPA052569)
Datasheet Anti TMEM42 pAb (ATL-HPA052569) Datasheet (External Link)
Vendor Page Anti TMEM42 pAb (ATL-HPA052569)