Anti TMEM38A pAb (ATL-HPA050463 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050463-100

• 
• 

Protein Description: transmembrane protein 38A
Gene Name: TMEM38A
Alternative Gene Name: MGC3169, TRIC-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031791: 78%, ENSRNOG00000011912: 78%
Entrez Gene ID: 79041
Uniprot ID: Q9H6F2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK
• Gene Sequence: THSHSSPFDALEGYICPVLFGSACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKK
• Gene ID - Mouse: ENSMUSG00000031791
• Gene ID - Rat: ENSRNOG00000011912
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.