Anti TMEM35A pAb (ATL-HPA048583 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048583-25

• 
• 
• 

Protein Description: transmembrane protein 35A
Gene Name: TMEM35A
Alternative Gene Name: FLJ14084, TMEM35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033578: 100%, ENSRNOG00000001506: 100%
Entrez Gene ID: 59353
Uniprot ID: Q53FP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDV
• Gene Sequence: PRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGALEVACGIVMTLVPGRPKDV
• Gene ID - Mouse: ENSMUSG00000033578
• Gene ID - Rat: ENSRNOG00000001506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TMEM35A pAb (ATL-HPA048583 w/enhanced validation) – 3 Found

Wichern, Franziska; Jensen, Majbrit M; Christensen, Ditte Z; Mikkelsen, Jens D; Gondré-Lewis, Marjorie C; Thomsen, Morten S. Perinatal nicotine treatment induces transient increases in NACHO protein levels in the rat frontal cortex. Neuroscience. 2017;346( 28131622):278-283. 

Wu, Meilin; Liu, Clifford Z; Barrall, Erika A; Rissman, Robert A; Joiner, William J. Unbalanced Regulation of α7 nAChRs by Ly6h and NACHO Contributes to Neurotoxicity in Alzheimer's Disease. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2021;41(41):8461-8474. 

Deshpande, Anish; Vinayakamoorthy, Remitha M; Garg, Brijesh K; Thummapudi, Jaya Prakash; Oza, Gauri; Adhikari, Ketaki; Agarwal, Aayush; Dalvi, Parnika; Iyer, Swetha; Thulasi Raman, Sarulatha; Ramesh, Vijay; Rameshbabu, Akshitha; Rezvaya, Alexandra; Sukumaran, Sneha; Swaminathan, Sweta; Tilak, Bhargav; Wang, Zhiyuan; Tran, Phu V; Loring, Ralph H. Why Does Knocking Out NACHO, But Not RIC3, Completely Block Expression of α7 Nicotinic Receptors in Mouse Brain?. Biomolecules. 2020;10(3)