Anti TMEM27 pAb (ATL-HPA048543 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048543-25
  • Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-TMEM27 antibody. Corresponding TMEM27 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line HaCaT shows localization to endoplasmic reticulum & vesicles.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: transmembrane protein 27
Gene Name: TMEM27
Alternative Gene Name: NX17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015401: 85%, ENSRNOG00000003960: 87%
Entrez Gene ID: 57393
Uniprot ID: Q9HBJ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLE
Gene Sequence LVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLE
Gene ID - Mouse ENSMUSG00000015401
Gene ID - Rat ENSRNOG00000003960
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti TMEM27 pAb (ATL-HPA048543 w/enhanced validation)
Datasheet Anti TMEM27 pAb (ATL-HPA048543 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TMEM27 pAb (ATL-HPA048543 w/enhanced validation)