Anti TMEM266 pAb (ATL-HPA049425)
Atlas Antibodies
- SKU:
- ATL-HPA049425-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TMEM266
Alternative Gene Name: C15orf27, FLJ38190
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032313: 95%, ENSRNOG00000015201: 94%
Entrez Gene ID: 123591
Uniprot ID: Q2M3C6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLE |
Gene Sequence | YVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLE |
Gene ID - Mouse | ENSMUSG00000032313 |
Gene ID - Rat | ENSRNOG00000015201 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TMEM266 pAb (ATL-HPA049425) | |
Datasheet | Anti TMEM266 pAb (ATL-HPA049425) Datasheet (External Link) |
Vendor Page | Anti TMEM266 pAb (ATL-HPA049425) at Atlas Antibodies |
Documents & Links for Anti TMEM266 pAb (ATL-HPA049425) | |
Datasheet | Anti TMEM266 pAb (ATL-HPA049425) Datasheet (External Link) |
Vendor Page | Anti TMEM266 pAb (ATL-HPA049425) |